Lineage for d2cx1a2 (2cx1 A:1-90)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 856194Superfamily d.17.6: Pre-PUA domain [88802] (5 families) (S)
    this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins
  5. 856215Family d.17.6.4: Hypothetical protein APE0525, N-terminal domain [143004] (1 protein)
  6. 856216Protein Hypothetical protein APE0525, N-terminal domain [143005] (1 species)
  7. 856217Species Archaeon Aeropyrum pernix [TaxId:56636] [143006] (3 PDB entries)
    Uniprot Q9YEQ6 1-90
  8. 856218Domain d2cx1a2: 2cx1 A:1-90 [130968]
    Other proteins in same PDB: d2cx1a1
    automatically matched to 1ZS7 A:1-90
    complexed with tla

Details for d2cx1a2

PDB Entry: 2cx1 (more details), 1.8 Å

PDB Description: Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
PDB Compounds: (A:) hypothetical protein APE0525

SCOP Domain Sequences for d2cx1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx1a2 d.17.6.4 (A:1-90) Hypothetical protein APE0525, N-terminal domain {Archaeon Aeropyrum pernix [TaxId: 56636]}
mlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeiit
vdgvpclfewsdgriyptlqclkafgvdwl

SCOP Domain Coordinates for d2cx1a2:

Click to download the PDB-style file with coordinates for d2cx1a2.
(The format of our PDB-style files is described here.)

Timeline for d2cx1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cx1a1