Lineage for d2cx1a1 (2cx1 A:91-183)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966930Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 966931Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 966932Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 966943Protein Hypothetical protein APE0525, C-terminal domain [141700] (1 species)
  7. 966944Species Aeropyrum pernix [TaxId:56636] [141701] (3 PDB entries)
    Uniprot Q9YEQ6 91-186
  8. 966945Domain d2cx1a1: 2cx1 A:91-183 [130967]
    Other proteins in same PDB: d2cx1a2
    automatically matched to 1ZS7 A:91-186
    complexed with tla

Details for d2cx1a1

PDB Entry: 2cx1 (more details), 1.8 Å

PDB Description: Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
PDB Compounds: (A:) hypothetical protein APE0525

SCOPe Domain Sequences for d2cx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx1a1 b.122.1.1 (A:91-183) Hypothetical protein APE0525, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
kgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtpvmvgvaevdssa
leklyrekargravrrvhrlgdalwelaqevgk

SCOPe Domain Coordinates for d2cx1a1:

Click to download the PDB-style file with coordinates for d2cx1a1.
(The format of our PDB-style files is described here.)

Timeline for d2cx1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cx1a2