SCOP 1.73: Domain d2cx1a1: 2cx1 A:91-183

Lineage for d2cx1a1 (2cx1 A:91-183)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (10 families)

5. Family b.122.1.1: PUA domain [88698] (5 proteins)
   RNA-binding domain

6. Protein Hypothetical protein APE0525, C-terminal domain [141700] (1 species)

7. Species Archaeon Aeropyrum pernix [TaxId:56636] [141701] (3 PDB entries)

8. Domain d2cx1a1: 2cx1 A:91-183 [130967]
   Other proteins in same PDB: d2cx1a2
   automatically matched to 1ZS7 A:91-186
   complexed with tla

Details for d2cx1a1

PDB Entry: 2cx1, 1.8 Å

PDB Description: Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)

PDB Compounds: (A:) hypothetical protein APE0525

SCOP Domain Sequences for d2cx1a1:

Sequence; same for both SEQRES and ATOM records:

>d2cx1a1 b.122.1.1 (A:91-183) Hypothetical protein APE0525, C-terminal domain {Archaeon Aeropyrum pernix [TaxId: 56636]}
kgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtpvmvgvaevdssa
leklyrekargravrrvhrlgdalwelaqevgk

Timeline for d2cx1a1:

• d2cx1a1 is new in SCOP 1.73
  
• d2cx1a1 appears in SCOP 1.75
  
• d2cx1a1 appears in the current release, SCOPe 2.08