![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.6: Pre-PUA domain [88802] (5 families) ![]() this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins |
![]() | Family d.17.6.4: Hypothetical protein APE0525, N-terminal domain [143004] (1 protein) |
![]() | Protein Hypothetical protein APE0525, N-terminal domain [143005] (1 species) |
![]() | Species Archaeon Aeropyrum pernix [TaxId:56636] [143006] (3 PDB entries) Uniprot Q9YEQ6 1-90 |
![]() | Domain d2cx0a2: 2cx0 A:1-90 [130966] Other proteins in same PDB: d2cx0a1 automatically matched to 1ZS7 A:1-90 complexed with so4 |
PDB Entry: 2cx0 (more details), 1.8 Å
SCOP Domain Sequences for d2cx0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx0a2 d.17.6.4 (A:1-90) Hypothetical protein APE0525, N-terminal domain {Archaeon Aeropyrum pernix [TaxId: 56636]} mlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeiit vdgvpclfewsdgriyptlqclkafgvdwl
Timeline for d2cx0a2: