SCOP 1.73: Domain d2cx0a2: 2cx0 A:1-90

Lineage for d2cx0a2 (2cx0 A:1-90)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.6: Pre-PUA domain [88802] (4 families)
   this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins

5. Family d.17.6.4: Hypothetical protein APE0525, N-terminal domain [143004] (1 protein)

6. Protein Hypothetical protein APE0525, N-terminal domain [143005] (1 species)

7. Species Archaeon Aeropyrum pernix [TaxId:56636] [143006] (3 PDB entries)

8. Domain d2cx0a2: 2cx0 A:1-90 [130966]
   Other proteins in same PDB: d2cx0a1
   automatically matched to 1ZS7 A:1-90
   complexed with so4

Details for d2cx0a2

PDB Entry: 2cx0, 1.8 Å

PDB Description: Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (sulfate complex)

PDB Compounds: (A:) hypothetical protein APE0525

SCOP Domain Sequences for d2cx0a2:

Sequence; same for both SEQRES and ATOM records:

>d2cx0a2 d.17.6.4 (A:1-90) Hypothetical protein APE0525, N-terminal domain {Archaeon Aeropyrum pernix [TaxId: 56636]}
mlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeiit
vdgvpclfewsdgriyptlqclkafgvdwl

Timeline for d2cx0a2:

• d2cx0a2 is new in SCOP 1.73
  
• d2cx0a2 appears in SCOP 1.75
  
• d2cx0a2 appears in the current release, SCOPe 2.08