Lineage for d2cx0a1 (2cx0 A:91-183)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2432835Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 2432846Protein Hypothetical protein APE0525, C-terminal domain [141700] (1 species)
  7. 2432847Species Aeropyrum pernix [TaxId:56636] [141701] (3 PDB entries)
    Uniprot Q9YEQ6 91-186
  8. 2432849Domain d2cx0a1: 2cx0 A:91-183 [130965]
    Other proteins in same PDB: d2cx0a2, d2cx0a3
    automated match to d2cx0a1
    complexed with so4

Details for d2cx0a1

PDB Entry: 2cx0 (more details), 1.8 Å

PDB Description: Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (sulfate complex)
PDB Compounds: (A:) hypothetical protein APE0525

SCOPe Domain Sequences for d2cx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx0a1 b.122.1.1 (A:91-183) Hypothetical protein APE0525, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
kgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtpvmvgvaevdssa
leklyrekargravrrvhrlgdalwelaqevgk

SCOPe Domain Coordinates for d2cx0a1:

Click to download the PDB-style file with coordinates for d2cx0a1.
(The format of our PDB-style files is described here.)

Timeline for d2cx0a1: