Class b: All beta proteins [48724] (178 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.1: PUA domain [88698] (6 proteins) RNA-binding domain |
Protein Hypothetical protein APE0525, C-terminal domain [141700] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [141701] (3 PDB entries) Uniprot Q9YEQ6 91-186 |
Domain d2cx0a1: 2cx0 A:91-183 [130965] Other proteins in same PDB: d2cx0a2, d2cx0a3 automated match to d2cx0a1 complexed with so4 |
PDB Entry: 2cx0 (more details), 1.8 Å
SCOPe Domain Sequences for d2cx0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx0a1 b.122.1.1 (A:91-183) Hypothetical protein APE0525, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} kgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtpvmvgvaevdssa leklyrekargravrrvhrlgdalwelaqevgk
Timeline for d2cx0a1: