SCOP 1.75: Domain d2cwzc1: 2cwz C:1-137

Lineage for d2cwzc1 (2cwz C:1-137)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.7: TTHA0967-like [143187] (2 proteins)
   contains extra C-terminal helix

6. Protein Hypothetical protein TTHA0967 [143188] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143189] (1 PDB entry)
   Uniprot Q5SJP1 1-138

8. Domain d2cwzc1: 2cwz C:1-137 [130963]
   automatically matched to 2CWZ A:1-138
   complexed with edo

Details for d2cwzc1

PDB Entry: 2cwz, 1.85 Å

PDB Description: Crystal structure of the Thermus thermophilus hypothetical protein TTHA0967, a thioesterase superfamily member

PDB Compounds: (C:) thioesterase family protein

SCOP Domain Sequences for d2cwzc1:

Sequence; same for both SEQRES and ATOM records:

>d2cwzc1 d.38.1.7 (C:1-137) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]}
mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
akvealfrrlkerweae

Timeline for d2cwzc1:

• d2cwzc1 first appeared in SCOP 1.73
  
• d2cwzc1 is called d2cwzc_ in SCOPe 2.01
  
• d2cwzc1 appears in the current release, SCOPe 2.08, called d2cwzc_