Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) |
Family d.38.1.7: TTHA0967-like [143187] (2 proteins) contains extra C-terminal helix |
Protein Hypothetical protein TTHA0967 [143188] (1 species) |
Species Thermus thermophilus [TaxId:274] [143189] (1 PDB entry) Uniprot Q5SJP1 1-138 |
Domain d2cwzc1: 2cwz C:1-137 [130963] automatically matched to 2CWZ A:1-138 complexed with edo |
PDB Entry: 2cwz (more details), 1.85 Å
SCOP Domain Sequences for d2cwzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwzc1 d.38.1.7 (C:1-137) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk akvealfrrlkerweae
Timeline for d2cwzc1: