SCOPe 2.07: Domain d2cwzb_: 2cwz B:

Lineage for d2cwzb_ (2cwz B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.7: TTHA0967-like [143187] (2 proteins)
   contains extra C-terminal helix

6. Protein Hypothetical protein TTHA0967 [143188] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143189] (1 PDB entry)
   Uniprot Q5SJP1 1-138

8. Domain d2cwzb_: 2cwz B: [130962]
   automated match to d2cwza1
   complexed with edo

Details for d2cwzb_

PDB Entry: 2cwz, 1.85 Å

PDB Description: Crystal structure of the Thermus thermophilus hypothetical protein TTHA0967, a thioesterase superfamily member

PDB Compounds: (B:) thioesterase family protein

SCOPe Domain Sequences for d2cwzb_:

Sequence; same for both SEQRES and ATOM records:

>d2cwzb_ d.38.1.7 (B:) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]}
mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
akvealfrrlkerweae

Timeline for d2cwzb_:

• d2cwzb_ first appeared in SCOP 1.73, called d2cwzb1
  
• d2cwzb_ appears in SCOPe 2.06
  
• d2cwzb_ appears in the current release, SCOPe 2.08