Lineage for d2cwza1 (2cwz A:1-138)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858980Family d.38.1.7: TTHA0967-like [143187] (2 proteins)
    contains extra C-terminal helix
  6. 858981Protein Hypothetical protein TTHA0967 [143188] (1 species)
  7. 858982Species Thermus thermophilus [TaxId:274] [143189] (1 PDB entry)
    Uniprot Q5SJP1 1-138
  8. 858983Domain d2cwza1: 2cwz A:1-138 [130961]
    complexed with edo

Details for d2cwza1

PDB Entry: 2cwz (more details), 1.85 Å

PDB Description: Crystal structure of the Thermus thermophilus hypothetical protein TTHA0967, a thioesterase superfamily member
PDB Compounds: (A:) thioesterase family protein

SCOP Domain Sequences for d2cwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]}
mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
akvealfrrlkerweaer

SCOP Domain Coordinates for d2cwza1:

Click to download the PDB-style file with coordinates for d2cwza1.
(The format of our PDB-style files is described here.)

Timeline for d2cwza1: