SCOPe 2.08: Domain d2cwxe2: 2cwx E:10-133

Lineage for d2cwxe2 (2cwx E:10-133)

1. Root: SCOPe 2.08
2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel
5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
7. Species Pyrococcus horikoshii [TaxId:53953] [143363] (2 PDB entries)
   Uniprot O58677 8-133
8. Domain d2cwxe2: 2cwx E:10-133 [130959]
   Other proteins in same PDB: d2cwxa1, d2cwxe1
   automated match to d2cwxa2

Details for d2cwxe2

PDB Entry: 2cwx, 2 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-1 crystal)

PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2cwxe2:

Sequence; same for both SEQRES and ATOM records:

>d2cwxe2 d.58.9.1 (E:10-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
wyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrsm
akvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppyey
lrhf

SCOPe Domain Coordinates for d2cwxe2 are not available.

Timeline for d2cwxe2:

• d2cwxe2 first appeared in SCOP 1.73
  
• d2cwxe2 appears in SCOPe 2.07