SCOP 1.75: Domain d2cwxe1: 2cwx E:134-417

Lineage for d2cwxe1 (2cwx E:134-417)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family)

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
   N-terminal domain is alpha+beta

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [141850] (3 PDB entries)
   Uniprot O58677 134-424

8. Domain d2cwxe1: 2cwx E:134-417 [130958]
   Other proteins in same PDB: d2cwxa2, d2cwxe2
   automatically matched to 2CWX A:134-424

Details for d2cwxe1

PDB Entry: 2cwx, 2 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-1 crystal)

PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOP Domain Sequences for d2cwxe1:

Sequence; same for both SEQRES and ATOM records:

>d2cwxe1 c.1.14.1 (E:134-417) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
kgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenfts
fpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmidi
vvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqihtg
tavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviqagg
gvmghpdgpragakalrdaidaaiegvdldekaksspelkkslr

Timeline for d2cwxe1:

• d2cwxe1 first appeared in SCOP 1.73
  
• d2cwxe1 appears in SCOPe 2.01
  
• d2cwxe1 appears in the current release, SCOPe 2.08