Lineage for d2cwxe1 (2cwx E:134-417)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838586Species Pyrococcus horikoshii [TaxId:53953] [141850] (3 PDB entries)
    Uniprot O58677 134-424
  8. 2838592Domain d2cwxe1: 2cwx E:134-417 [130958]
    Other proteins in same PDB: d2cwxa2, d2cwxe2
    automated match to d2cwxa1

Details for d2cwxe1

PDB Entry: 2cwx (more details), 2 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-1 crystal)
PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2cwxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwxe1 c.1.14.1 (E:134-417) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
kgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenfts
fpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmidi
vvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqihtg
tavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviqagg
gvmghpdgpragakalrdaidaaiegvdldekaksspelkkslr

SCOPe Domain Coordinates for d2cwxe1:

Click to download the PDB-style file with coordinates for d2cwxe1.
(The format of our PDB-style files is described here.)

Timeline for d2cwxe1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cwxe2