Lineage for d2cwxa2 (2cwx A:8-133)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195894Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2195895Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2195896Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 2195959Species Pyrococcus horikoshii [TaxId:53953] [143363] (2 PDB entries)
    Uniprot O58677 8-133
  8. 2195964Domain d2cwxa2: 2cwx A:8-133 [130957]
    Other proteins in same PDB: d2cwxa1, d2cwxe1

Details for d2cwxa2

PDB Entry: 2cwx (more details), 2 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-1 crystal)
PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2cwxa2:

Sequence, based on SEQRES records: (download)

>d2cwxa2 d.58.9.1 (A:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakr
smakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppy
eylrhf

Sequence, based on observed residues (ATOM records): (download)

>d2cwxa2 d.58.9.1 (A:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtlwklpemakrsma
kvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppyeyl
rhf

SCOPe Domain Coordinates for d2cwxa2:

Click to download the PDB-style file with coordinates for d2cwxa2.
(The format of our PDB-style files is described here.)

Timeline for d2cwxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cwxa1