![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143363] (3 PDB entries) Uniprot O58677 8-133 |
![]() | Domain d2cwxa2: 2cwx A:8-133 [130957] Other proteins in same PDB: d2cwxa1, d2cwxe1 |
PDB Entry: 2cwx (more details), 2 Å
SCOP Domain Sequences for d2cwxa2:
Sequence, based on SEQRES records: (download)
>d2cwxa2 d.58.9.1 (A:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakr smakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppy eylrhf
>d2cwxa2 d.58.9.1 (A:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtlwklpemakrsma kvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppyeyl rhf
Timeline for d2cwxa2: