SCOPe 2.07: Domain d2cwwb2: 2cww B:65-382

Lineage for d2cwwb2 (2cww B:65-382)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins)
   C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam PF05958)

6. Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries)
   Uniprot Q5SIT4 65-382

8. Domain d2cwwb2: 2cww B:65-382 [130955]
   Other proteins in same PDB: d2cwwa1, d2cwwb1
   automated match to d1wxwa2
   protein/RNA complex; complexed with acy, gol, sah

Details for d2cwwb2

PDB Entry: 2cww, 2.6 Å

PDB Description: Crystal structure of Thermus thermophilus TTHA1280, a putative SAM-dependent RNA methyltransferase, in complex with S-adenosyl-L-homocysteine

PDB Compounds: (B:) putative SAM-dependent RNA methyltransferase

SCOPe Domain Sequences for d2cwwb2:

Sequence; same for both SEQRES and ATOM records:

>d2cwwb2 c.66.1.51 (B:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal
rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray
kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv
llnhpethylkfavfqvl

Timeline for d2cwwb2:

• d2cwwb2 first appeared in SCOP 1.73
  
• d2cwwb2 appears in SCOPe 2.06
  
• d2cwwb2 appears in the current release, SCOPe 2.08