Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) |
Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins) C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam 05958) |
Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species) |
Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries) |
Domain d2cwwb2: 2cww B:65-382 [130955] Other proteins in same PDB: d2cwwa1, d2cwwb1 automatically matched to 1WXW A:65-382 complexed with acy, gol, sah |
PDB Entry: 2cww (more details), 2.6 Å
SCOP Domain Sequences for d2cwwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwwb2 c.66.1.51 (B:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv llnhpethylkfavfqvl
Timeline for d2cwwb2: