Lineage for d2cwwb1 (2cww B:1-64)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088067Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2088068Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2088231Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
    N-terminal part of Pfam PF03602, structurally similar to PUA domain family
  6. 2088240Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species)
  7. 2088241Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries)
    Uniprot Q5SIT4 1-164
  8. 2088251Domain d2cwwb1: 2cww B:1-64 [130954]
    Other proteins in same PDB: d2cwwa2, d2cwwb2
    automated match to d1wxwa1
    protein/RNA complex; complexed with acy, gol, sah

Details for d2cwwb1

PDB Entry: 2cww (more details), 2.6 Å

PDB Description: Crystal structure of Thermus thermophilus TTHA1280, a putative SAM-dependent RNA methyltransferase, in complex with S-adenosyl-L-homocysteine
PDB Compounds: (B:) putative SAM-dependent RNA methyltransferase

SCOPe Domain Sequences for d2cwwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwwb1 b.122.1.9 (B:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
rfap

SCOPe Domain Coordinates for d2cwwb1:

Click to download the PDB-style file with coordinates for d2cwwb1.
(The format of our PDB-style files is described here.)

Timeline for d2cwwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cwwb2