SCOP 1.73: Domain d2cwwb1: 2cww B:1-64

Lineage for d2cwwb1 (2cww B:1-64)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (10 families)

5. Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
   N-terminal part of Pfam PF03602, structurally similar to PUA domain family

6. Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species)

7. Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries)

8. Domain d2cwwb1: 2cww B:1-64 [130954]
   Other proteins in same PDB: d2cwwa2, d2cwwb2
   automatically matched to 1WXW A:1-64
   complexed with acy, gol, sah

Details for d2cwwb1

PDB Entry: 2cww, 2.6 Å

PDB Description: Crystal structure of Thermus thermophilus TTHA1280, a putative SAM-dependent RNA methyltransferase, in complex with S-adenosyl-L-homocysteine

PDB Compounds: (B:) putative SAM-dependent RNA methyltransferase

SCOP Domain Sequences for d2cwwb1:

Sequence; same for both SEQRES and ATOM records:

>d2cwwb1 b.122.1.9 (B:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
rfap

Timeline for d2cwwb1:

• d2cwwb1 is new in SCOP 1.73
  
• d2cwwb1 appears in SCOP 1.75
  
• d2cwwb1 appears in the current release, SCOPe 2.08