Lineage for d2cwwa2 (2cww A:65-382)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130452Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 protein domains)
    C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam PF05958)
  6. 2130461Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species)
  7. 2130462Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries)
    Uniprot Q5SIT4 65-382
  8. 2130471Domain d2cwwa2: 2cww A:65-382 [130953]
    Other proteins in same PDB: d2cwwa1, d2cwwb1
    automated match to d1wxwa2
    protein/RNA complex; complexed with acy, gol, sah

Details for d2cwwa2

PDB Entry: 2cww (more details), 2.6 Å

PDB Description: Crystal structure of Thermus thermophilus TTHA1280, a putative SAM-dependent RNA methyltransferase, in complex with S-adenosyl-L-homocysteine
PDB Compounds: (A:) putative SAM-dependent RNA methyltransferase

SCOPe Domain Sequences for d2cwwa2:

Sequence, based on SEQRES records: (download)

>d2cwwa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal
rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray
kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv
llnhpethylkfavfqvl

Sequence, based on observed residues (ATOM records): (download)

>d2cwwa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaealrraeen
arlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayraykevnlr
aikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpvllnhpe
thylkfavfqvl

SCOPe Domain Coordinates for d2cwwa2:

Click to download the PDB-style file with coordinates for d2cwwa2.
(The format of our PDB-style files is described here.)

Timeline for d2cwwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cwwa1