![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins) C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam PF05958) |
![]() | Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries) Uniprot Q5SIT4 65-382 |
![]() | Domain d2cwwa2: 2cww A:65-382 [130953] Other proteins in same PDB: d2cwwa1, d2cwwb1 automated match to d1wxwa2 protein/RNA complex; complexed with acy, gol, sah |
PDB Entry: 2cww (more details), 2.6 Å
SCOPe Domain Sequences for d2cwwa2:
Sequence, based on SEQRES records: (download)
>d2cwwa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv llnhpethylkfavfqvl
>d2cwwa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv dlgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaealrraeen arlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayraykevnlr aikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpvllnhpe thylkfavfqvl
Timeline for d2cwwa2: