![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins) N-terminal part of Pfam PF03602, structurally similar to PUA domain family |
![]() | Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries) Uniprot Q5SIT4 1-164 |
![]() | Domain d2cwwa1: 2cww A:1-64 [130952] Other proteins in same PDB: d2cwwa2, d2cwwb2 automated match to d1wxwa1 protein/RNA complex; complexed with acy, gol, sah |
PDB Entry: 2cww (more details), 2.6 Å
SCOPe Domain Sequences for d2cwwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwwa1 b.122.1.9 (A:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]} mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray rfap
Timeline for d2cwwa1: