SCOPe 2.08: Domain d2cwwa1: 2cww A:1-64

Lineage for d2cwwa1 (2cww A:1-64)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
   N-terminal part of Pfam PF03602, structurally similar to PUA domain family

6. Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species)

7. Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries)
   Uniprot Q5SIT4 1-164

8. Domain d2cwwa1: 2cww A:1-64 [130952]
   Other proteins in same PDB: d2cwwa2, d2cwwb2
   automated match to d1wxwa1
   protein/RNA complex; complexed with acy, gol, sah

Details for d2cwwa1

PDB Entry: 2cww, 2.6 Å

PDB Description: Crystal structure of Thermus thermophilus TTHA1280, a putative SAM-dependent RNA methyltransferase, in complex with S-adenosyl-L-homocysteine

PDB Compounds: (A:) putative SAM-dependent RNA methyltransferase

SCOPe Domain Sequences for d2cwwa1:

Sequence; same for both SEQRES and ATOM records:

>d2cwwa1 b.122.1.9 (A:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
rfap

Timeline for d2cwwa1:

• d2cwwa1 first appeared in SCOP 1.73
  
• d2cwwa1 appears in SCOPe 2.07