SCOPe 2.03: Domain d2cwvb3: 2cwv B:97-211

Lineage for d2cwvb3 (2cwv B:97-211)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
   Uniprot P46881 9-628

8. Domain d2cwvb3: 2cwv B:97-211 [130951]
   Other proteins in same PDB: d2cwva1, d2cwvb1
   automatically matched to d1av4_3
   complexed with cu

Details for d2cwvb3

PDB Entry: 2cwv, 1.85 Å

PDB Description: product schiff-base intermediate of copper amine oxidase from arthrobacter globiformis

PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cwvb3:

Sequence; same for both SEQRES and ATOM records:

>d2cwvb3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d2cwvb3:

• d2cwvb3 first appeared in SCOP 1.73
  
• d2cwvb3 appears in SCOPe 2.02
  
• d2cwvb3 appears in SCOPe 2.04
  
• d2cwvb3 appears in the current release, SCOPe 2.08