Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries) Uniprot P46881 9-628 |
Domain d2cwua3: 2cwu A:97-211 [130942] Other proteins in same PDB: d2cwua1, d2cwub1 automatically matched to d1av4_3 complexed with cu |
PDB Entry: 2cwu (more details), 1.85 Å
SCOPe Domain Sequences for d2cwua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwua3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]} elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg
Timeline for d2cwua3: