Lineage for d2cwua3 (2cwu A:97-211)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. Domain d2cwua3: 2cwu A:97-211 [130942]
    Other proteins in same PDB: d2cwua1, d2cwub1
    automatically matched to d1av4_3
    complexed with cu

Details for d2cwua3

PDB Entry: 2cwu (more details), 1.85 Å

PDB Description: Substrate schiff-base intermediate of copper amine oxidase from arthrobacter globiformis
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cwua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwua3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOPe Domain Coordinates for d2cwua3 are not available.

Timeline for d2cwua3:

Domains from same chain:
(mouse over for more information)
d2cwua1, d2cwua2
Domains from other chains:
(mouse over for more information)
d2cwub1, d2cwub2, d2cwub3