Lineage for d2cwua2 (2cwu A:9-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935960Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2935961Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2935962Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2935963Species Arthrobacter globiformis [TaxId:1665] [54421] (41 PDB entries)
    Uniprot P46881 9-628
  8. 2935980Domain d2cwua2: 2cwu A:9-96 [130941]
    Other proteins in same PDB: d2cwua1, d2cwub1
    automatically matched to d1av4_2
    complexed with cu

Details for d2cwua2

PDB Entry: 2cwu (more details), 1.85 Å

PDB Description: substrate schiff-base intermediate of copper amine oxidase from arthrobacter globiformis
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cwua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwua2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOPe Domain Coordinates for d2cwua2:

Click to download the PDB-style file with coordinates for d2cwua2.
(The format of our PDB-style files is described here.)

Timeline for d2cwua2: