Lineage for d2cwqc_ (2cwq C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348132Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2348133Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2348259Family a.152.1.4: TTHA0727-like [140975] (2 proteins)
    similar to the CMD-like family by the subunit sequence and hexameric architecture; the segment-swapped subunit fold is similar to the AhpD domains
  6. 2348264Protein Hypothetical protein TTHA0727 [140976] (1 species)
  7. 2348265Species Thermus thermophilus [TaxId:274] [140977] (1 PDB entry)
    Uniprot Q5SMF5 1-117
  8. 2348268Domain d2cwqc_: 2cwq C: [130933]
    Other proteins in same PDB: d2cwqa2, d2cwqb3
    automated match to d2cwqa1

Details for d2cwqc_

PDB Entry: 2cwq (more details), 1.9 Å

PDB Description: Crystal structure of conserved protein TTHA0727 from Thermus thermophilus HB8
PDB Compounds: (C:) hypothetical protein TTHA0727

SCOPe Domain Sequences for d2cwqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwqc_ a.152.1.4 (C:) Hypothetical protein TTHA0727 {Thermus thermophilus [TaxId: 274]}
ervlqamaenlgeglpraipllaekapglllehgrswtyampekgaldektrtlillgia
latgseacvkamahrakrlglskealletlkiarqaqanavlghaapllevl

SCOPe Domain Coordinates for d2cwqc_:

Click to download the PDB-style file with coordinates for d2cwqc_.
(The format of our PDB-style files is described here.)

Timeline for d2cwqc_: