![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
![]() | Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
![]() | Family a.152.1.4: TTHA0727-like [140975] (2 proteins) similar to the CMD-like family by the subunit sequence and hexameric architecture; the segment-swapped subunit fold is similar to the AhpD domains |
![]() | Protein Hypothetical protein TTHA0727 [140976] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [140977] (1 PDB entry) Uniprot Q5SMF5 1-117 |
![]() | Domain d2cwqc_: 2cwq C: [130933] Other proteins in same PDB: d2cwqa2, d2cwqb3 automated match to d2cwqa1 |
PDB Entry: 2cwq (more details), 1.9 Å
SCOPe Domain Sequences for d2cwqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwqc_ a.152.1.4 (C:) Hypothetical protein TTHA0727 {Thermus thermophilus [TaxId: 274]} ervlqamaenlgeglpraipllaekapglllehgrswtyampekgaldektrtlillgia latgseacvkamahrakrlglskealletlkiarqaqanavlghaapllevl
Timeline for d2cwqc_:
![]() Domains from other chains: (mouse over for more information) d2cwqa1, d2cwqa2, d2cwqb2, d2cwqb3 |