Class a: All alpha proteins [46456] (290 folds) |
Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) probable biological unit contains six domains of this fold arranged with 32 symmetry |
Family a.152.1.4: TTHA0727-like [140975] (2 proteins) similar to the CMD-like family by the subunit sequence and hexameric architecture; the segment-swapped subunit fold is similar to the AhpD domains |
Protein Hypothetical protein TTHA0727 [140976] (1 species) |
Species Thermus thermophilus [TaxId:274] [140977] (1 PDB entry) Uniprot Q5SMF5 1-117 |
Domain d2cwqb2: 2cwq B:1-117 [130932] Other proteins in same PDB: d2cwqa2, d2cwqb3 automated match to d2cwqa1 |
PDB Entry: 2cwq (more details), 1.9 Å
SCOPe Domain Sequences for d2cwqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwqb2 a.152.1.4 (B:1-117) Hypothetical protein TTHA0727 {Thermus thermophilus [TaxId: 274]} mdrthervlqamaenlgeglpraipllaekapglllehgrswtyampekgaldektrtli llgialatgseacvkamahrakrlglskealletlkiarqaqanavlghaapllevl
Timeline for d2cwqb2: