Lineage for d2cwqa1 (2cwq A:1-117)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650162Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 650163Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 650235Family a.152.1.4: TTHA0727-like [140975] (1 protein)
    similar to the CMD-like family by the subunit sequence and hexameric architecture; the segment-swapped subunit fold is similar to the AhpD domains
  6. 650236Protein Hypothetical protein TTHA0727 [140976] (1 species)
  7. 650237Species Thermus thermophilus [TaxId:274] [140977] (1 PDB entry)
  8. 650238Domain d2cwqa1: 2cwq A:1-117 [130931]

Details for d2cwqa1

PDB Entry: 2cwq (more details), 1.9 Å

PDB Description: Crystal structure of conserved protein TTHA0727 from Thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TTHA0727

SCOP Domain Sequences for d2cwqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwqa1 a.152.1.4 (A:1-117) Hypothetical protein TTHA0727 {Thermus thermophilus [TaxId: 274]}
mdrthervlqamaenlgeglpraipllaekapglllehgrswtyampekgaldektrtli
llgialatgseacvkamahrakrlglskealletlkiarqaqanavlghaapllevl

SCOP Domain Coordinates for d2cwqa1:

Click to download the PDB-style file with coordinates for d2cwqa1.
(The format of our PDB-style files is described here.)

Timeline for d2cwqa1: