SCOPe 2.08: Domain d2cwqa1: 2cwq A:1-117

Lineage for d2cwqa1 (2cwq A:1-117)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.4: TTHA0727-like [140975] (2 proteins)
   similar to the CMD-like family by the subunit sequence and hexameric architecture; the segment-swapped subunit fold is similar to the AhpD domains

6. Protein Hypothetical protein TTHA0727 [140976] (1 species)

7. Species Thermus thermophilus [TaxId:274] [140977] (1 PDB entry)
   Uniprot Q5SMF5 1-117

8. Domain d2cwqa1: 2cwq A:1-117 [130931]
   Other proteins in same PDB: d2cwqa2, d2cwqb3

Details for d2cwqa1

PDB Entry: 2cwq, 1.9 Å

PDB Description: Crystal structure of conserved protein TTHA0727 from Thermus thermophilus HB8

PDB Compounds: (A:) hypothetical protein TTHA0727

SCOPe Domain Sequences for d2cwqa1:

Sequence; same for both SEQRES and ATOM records:

>d2cwqa1 a.152.1.4 (A:1-117) Hypothetical protein TTHA0727 {Thermus thermophilus [TaxId: 274]}
mdrthervlqamaenlgeglpraipllaekapglllehgrswtyampekgaldektrtli
llgialatgseacvkamahrakrlglskealletlkiarqaqanavlghaapllevl

Timeline for d2cwqa1:

• d2cwqa1 first appeared in SCOP 1.73
  
• d2cwqa1 appears in SCOPe 2.07