Lineage for d2cwnb1 (2cwn B:13-331)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684316Protein Transaldolase [51588] (3 species)
    probably related to class I aldolases by a circular permutation
  7. 684335Species Mouse (Mus musculus) [TaxId:10090] [141835] (1 PDB entry)
  8. 684337Domain d2cwnb1: 2cwn B:13-331 [130930]
    automatically matched to 2CWN A:13-331
    mutant

Details for d2cwnb1

PDB Entry: 2cwn (more details), 2.1 Å

PDB Description: crystal structure of mouse transaldolase
PDB Compounds: (B:) Transaldolase

SCOP Domain Sequences for d2cwnb1:

Sequence, based on SEQRES records: (download)

>d2cwnb1 c.1.10.1 (B:13-331) Transaldolase {Mouse (Mus musculus) [TaxId: 10090]}
saldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkkl
ggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielykea
gvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvgr
ildwhvantdkksyepqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagcdf
ltispkllgellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsdgi
rkfaadaiklermltermf

Sequence, based on observed residues (ATOM records): (download)

>d2cwnb1 c.1.10.1 (B:13-331) Transaldolase {Mouse (Mus musculus) [TaxId: 10090]}
saldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkkl
ggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielykea
gvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvgr
ildwhvanqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagcdfltispkll
gellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsdgirkfaadai
klermltermf

SCOP Domain Coordinates for d2cwnb1:

Click to download the PDB-style file with coordinates for d2cwnb1.
(The format of our PDB-style files is described here.)

Timeline for d2cwnb1: