Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187041] (2 PDB entries) |
Domain d2cwnb_: 2cwn B: [130930] Other proteins in same PDB: d2cwna1, d2cwna2 automated match to d1f05a_ |
PDB Entry: 2cwn (more details), 2.1 Å
SCOPe Domain Sequences for d2cwnb_:
Sequence, based on SEQRES records: (download)
>d2cwnb_ c.1.10.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} saldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkkl ggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielykea gvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvgr ildwhvantdkksyepqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagcdf ltispkllgellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsdgi rkfaadaiklermltermfs
>d2cwnb_ c.1.10.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} saldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkkl ggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielykea gvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvgr ildwhvanqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagcdfltispkll gellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsdgirkfaadai klermltermfs
Timeline for d2cwnb_: