Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Transaldolase [51588] (3 species) probably related to class I aldolases by a circular permutation |
Species Mouse (Mus musculus) [TaxId:10090] [141835] (1 PDB entry) Uniprot Q93092 13-331 |
Domain d2cwna1: 2cwn A:13-331 [130929] Other proteins in same PDB: d2cwnb_ |
PDB Entry: 2cwn (more details), 2.1 Å
SCOPe Domain Sequences for d2cwna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwna1 c.1.10.1 (A:13-331) Transaldolase {Mouse (Mus musculus) [TaxId: 10090]} saldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkkl ggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielykea gvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvgr ildwhvantdkksyepqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagcdf ltispkllgellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsdgi rkfaadaiklermltermf
Timeline for d2cwna1: