Lineage for d2cwla1 (2cwl A:1-299)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766909Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)
  6. 766910Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 766930Species Thermus thermophilus [TaxId:274] [140444] (1 PDB entry)
    Uniprot Q5SM21 1-299
  8. 766931Domain d2cwla1: 2cwl A:1-299 [130927]

Details for d2cwla1

PDB Entry: 2cwl (more details), 1.65 Å

PDB Description: Crystal structure of manganese-free form of pseudocatalase from Thermus thermophilus HB8
PDB Compounds: (A:) manganese-free pseudocatalase

SCOP Domain Sequences for d2cwla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwla1 a.25.1.3 (A:1-299) Manganese catalase (T-catalase) {Thermus thermophilus [TaxId: 274]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklye

SCOP Domain Coordinates for d2cwla1:

Click to download the PDB-style file with coordinates for d2cwla1.
(The format of our PDB-style files is described here.)

Timeline for d2cwla1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cwlb1