Lineage for d2cwkb_ (2cwk B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027789Protein automated matches [190032] (8 species)
    not a true protein
  7. 1027919Species Pyrococcus horikoshii [TaxId:70601] [187576] (1 PDB entry)
  8. 1027920Domain d2cwkb_: 2cwk B: [130926]
    Other proteins in same PDB: d2cwka1
    automated match to d2cwka1

Details for d2cwkb_

PDB Entry: 2cwk (more details), 1.75 Å

PDB Description: Crystal structure of nucleotide diphosphate kinase from Pyrococcus horikoshii
PDB Compounds: (B:) nucleoside-diphosphate kinase

SCOPe Domain Sequences for d2cwkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwkb_ d.58.6.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfyk

SCOPe Domain Coordinates for d2cwkb_:

Click to download the PDB-style file with coordinates for d2cwkb_.
(The format of our PDB-style files is described here.)

Timeline for d2cwkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cwka1