SCOP 1.73: Domain d2cwkb1: 2cwk B:6-157

Lineage for d2cwkb1 (2cwk B:6-157)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)

8. Domain d2cwkb1: 2cwk B:6-157 [130926]
   automatically matched to 2CWK A:6-158

Details for d2cwkb1

PDB Entry: 2cwk, 1.75 Å

PDB Description: Crystal structure of nucleotide diphosphate kinase from Pyrococcus horikoshii

PDB Compounds: (B:) nucleoside-diphosphate kinase

SCOP Domain Sequences for d2cwkb1:

Sequence; same for both SEQRES and ATOM records:

>d2cwkb1 d.58.6.1 (B:6-157) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfyk

Timeline for d2cwkb1:

• d2cwkb1 is new in SCOP 1.73
  
• d2cwkb1 appears in SCOP 1.75
  
• d2cwkb1 appears in the current release, SCOPe 2.07, called d2cwkb_