Lineage for d2cwkb1 (2cwk B:6-157)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724105Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
  8. 724115Domain d2cwkb1: 2cwk B:6-157 [130926]
    automatically matched to 2CWK A:6-158

Details for d2cwkb1

PDB Entry: 2cwk (more details), 1.75 Å

PDB Description: Crystal structure of nucleotide diphosphate kinase from Pyrococcus horikoshii
PDB Compounds: (B:) nucleoside-diphosphate kinase

SCOP Domain Sequences for d2cwkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwkb1 d.58.6.1 (B:6-157) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfyk

SCOP Domain Coordinates for d2cwkb1:

Click to download the PDB-style file with coordinates for d2cwkb1.
(The format of our PDB-style files is described here.)

Timeline for d2cwkb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cwka1