![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein automated matches [190032] (18 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [187576] (1 PDB entry) |
![]() | Domain d2cwkb_: 2cwk B: [130926] Other proteins in same PDB: d2cwka1 automated match to d2cwka1 |
PDB Entry: 2cwk (more details), 1.75 Å
SCOPe Domain Sequences for d2cwkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwkb_ d.58.6.1 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha sdskesaereislffkpeelfeypraadwfyk
Timeline for d2cwkb_: