Lineage for d2cwka1 (2cwk A:6-158)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651587Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1651588Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1651589Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 1651744Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
    Uniprot O58429 3-155
  8. 1651753Domain d2cwka1: 2cwk A:6-158 [130925]
    Other proteins in same PDB: d2cwkb_

Details for d2cwka1

PDB Entry: 2cwk (more details), 1.75 Å

PDB Description: Crystal structure of nucleotide diphosphate kinase from Pyrococcus horikoshii
PDB Compounds: (A:) nucleoside-diphosphate kinase

SCOPe Domain Sequences for d2cwka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwka1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfykk

SCOPe Domain Coordinates for d2cwka1:

Click to download the PDB-style file with coordinates for d2cwka1.
(The format of our PDB-style files is described here.)

Timeline for d2cwka1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cwkb_