SCOP 1.73: Domain d2cwib1: 2cwi B:1-129

Lineage for d2cwib1 (2cwi B:1-129)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries)

8. Domain d2cwib1: 2cwi B:1-129 [130923]
   automatically matched to d1el1a_
   complexed with so4

Details for d2cwib1

PDB Entry: 2cwi, 1.94 Å

PDB Description: x-ray crystal structure analysis of recombinant wild-type canine milk lysozyme (apo-type)

PDB Compounds: (B:) Lysozyme C, milk isozyme

SCOP Domain Sequences for d2cwib1:

Sequence; same for both SEQRES and ATOM records:

>d2cwib1 d.2.1.2 (B:1-129) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]}
kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifqln
skwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkdl
skylascnl

Timeline for d2cwib1:

• d2cwib1 is new in SCOP 1.73
  
• d2cwib1 appears in SCOP 1.75
  
• d2cwib1 appears in the current release, SCOPe 2.08, called d2cwib_