SCOPe 2.08: Domain d2cwib_: 2cwi B:

Lineage for d2cwib_ (2cwi B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (15 species)
   ubiquitous in a variety of tissues and secretions

7. Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries)

8. Domain d2cwib_: 2cwi B: [130923]
   automated match to d1el1a_
   complexed with so4

Details for d2cwib_

PDB Entry: 2cwi, 1.94 Å

PDB Description: x-ray crystal structure analysis of recombinant wild-type canine milk lysozyme (apo-type)

PDB Compounds: (B:) Lysozyme C, milk isozyme

SCOPe Domain Sequences for d2cwib_:

Sequence; same for both SEQRES and ATOM records:

>d2cwib_ d.2.1.2 (B:) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]}
kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifqln
skwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkdl
skylascnl

Timeline for d2cwib_:

• d2cwib_ first appeared in SCOP 1.73, called d2cwib1
  
• d2cwib_ appears in SCOPe 2.07