Lineage for d2cwia1 (2cwi A:1-129)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850037Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 850101Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 850412Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries)
  8. 850416Domain d2cwia1: 2cwi A:1-129 [130922]
    automatically matched to d1el1a_
    complexed with so4

Details for d2cwia1

PDB Entry: 2cwi (more details), 1.94 Å

PDB Description: x-ray crystal structure analysis of recombinant wild-type canine milk lysozyme (apo-type)
PDB Compounds: (A:) Lysozyme C, milk isozyme

SCOP Domain Sequences for d2cwia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwia1 d.2.1.2 (A:1-129) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]}
kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifqln
skwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkdl
skylascnl

SCOP Domain Coordinates for d2cwia1:

Click to download the PDB-style file with coordinates for d2cwia1.
(The format of our PDB-style files is described here.)

Timeline for d2cwia1: