Lineage for d2cwea1 (2cwe A:2-192)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907126Family a.4.5.58: Hypothetical protein PH1932 [116798] (1 protein)
    contains new dimerisation all-alpha C-terminal subdomain
  6. 907127Protein Hypothetical protein PH1932 [116799] (1 species)
  7. 907128Species Pyrococcus horikoshii [TaxId:53953] [116800] (2 PDB entries)
    Uniprot O59595
  8. 907130Domain d2cwea1: 2cwe A:2-192 [130921]

Details for d2cwea1

PDB Entry: 2cwe (more details), 2.7 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator protein, PH1932 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical transcription regulator protein, PH1932

SCOPe Domain Sequences for d2cwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwea1 a.4.5.58 (A:2-192) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]}
akkvkvitdpevikvmledtrrkilkllrnkemtisqlseilgktpqtiyhhieklkeag
lvevkrtemkgnlvekyygrtadvfyinlylgdeelryiarsrlktkidifkrlgyqfee
nellnimdrmsqkefdatvriskyieekedalkdfsnediihaiewlstaelardeeyle
llkrlgsilkr

SCOPe Domain Coordinates for d2cwea1:

Click to download the PDB-style file with coordinates for d2cwea1.
(The format of our PDB-style files is described here.)

Timeline for d2cwea1: