Lineage for d2cw9a1 (2cw9 A:270-451)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937000Family d.17.4.13: TIM44-like [143001] (2 proteins)
    contains extra N-terminal helices but lacks the beta-hairpin in the superfamily-specific insertion
    automatically mapped to Pfam PF04280
  6. 2937001Protein Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain [143002] (2 species)
  7. 2937004Species Human (Homo sapiens) [TaxId:9606] [143003] (1 PDB entry)
    Uniprot O43615 270-451
  8. 2937005Domain d2cw9a1: 2cw9 A:270-451 [130920]
    complexed with 1pe

Details for d2cw9a1

PDB Entry: 2cw9 (more details), 1.9 Å

PDB Description: Crystal structure of human Tim44 C-terminal domain
PDB Compounds: (A:) translocase of inner mitochondrial membrane

SCOPe Domain Sequences for d2cw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw9a1 d.17.4.13 (A:270-451) Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nafirasraltdkvtdllgglfsktemsevlteilrvdpafdkdrflkqcendiipnvle
amisgeldilkdwcyeatysqlahpiqqakalglqfhsrildidnvdlamgkmveqgpvl
iitfqaqlvmvvrnpkgevvegdpdkvlrmlyvwalcrdqdelnpyaawrlldisasste
qi

SCOPe Domain Coordinates for d2cw9a1:

Click to download the PDB-style file with coordinates for d2cw9a1.
(The format of our PDB-style files is described here.)

Timeline for d2cw9a1: