Lineage for d2cw1a1 (2cw1 A:1-65)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048451Fold k.46: Cro lambda fold design [144349] (1 superfamily)
  4. 3048452Superfamily k.46.1: Cro lambda fold design [144350] (1 family) (S)
  5. 3048453Family k.46.1.1: Cro lambda fold design [144351] (1 protein)
  6. 3048454Protein Sn4m [144352] (1 species)
  7. 3048455Species Synthetic [144353] (1 PDB entry)
  8. 3048456Domain d2cw1a1: 2cw1 A:1-65 [130918]

Details for d2cw1a1

PDB Entry: 2cw1 (more details)

PDB Description: solution structure of the de novo-designed lambda cro fold protein
PDB Compounds: (A:) SN4m

SCOPe Domain Sequences for d2cw1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw1a1 k.46.1.1 (A:1-65) Sn4m {Synthetic}
mrkkldlkkfvedknqeyaaralglsqklieevlkrglpvyvetnkdgnikvyitqdgit
qpfpp

SCOPe Domain Coordinates for d2cw1a1:

Click to download the PDB-style file with coordinates for d2cw1a1.
(The format of our PDB-style files is described here.)

Timeline for d2cw1a1: