Lineage for d2cw0f2 (2cw0 F:319-423)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907774Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 907807Family a.4.13.2: Sigma4 domain [88665] (4 proteins)
  6. 907815Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 907826Species Thermus thermophilus [TaxId:274] [88667] (9 PDB entries)
    Uniprot Q9WX78
  8. 907843Domain d2cw0f2: 2cw0 F:319-423 [130906]
    Other proteins in same PDB: d2cw0a1, d2cw0a2, d2cw0b1, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f3, d2cw0k1, d2cw0k2, d2cw0l1, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p3
    automatically matched to d1iw7f2
    complexed with mg, zn

Details for d2cw0f2

PDB Entry: 2cw0 (more details), 3.3 Å

PDB Description: crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2cw0f2:

Sequence, based on SEQRES records: (download)

>d2cw0f2 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d2cw0f2 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOPe Domain Coordinates for d2cw0f2:

Click to download the PDB-style file with coordinates for d2cw0f2.
(The format of our PDB-style files is described here.)

Timeline for d2cw0f2: