| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
| Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
| Protein RNA polymerase alpha subunit [56555] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d2cw0a2: 2cw0 A:50-172 [130899] Other proteins in same PDB: d2cw0a1, d2cw0b1, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k1, d2cw0l1, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p2, d2cw0p3 automatically matched to d1iw7a2 complexed with mg, zn |
PDB Entry: 2cw0 (more details), 3.3 Å
SCOPe Domain Sequences for d2cw0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cw0a2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs
Timeline for d2cw0a2: