Lineage for d2cvzd2 (2cvz D:2-157)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 821720Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 821797Protein Hydroxyisobutyrate dehydrogenase [102171] (3 species)
  7. 821802Species Thermus thermophilus [TaxId:274] [102172] (2 PDB entries)
    structural genomics
  8. 821806Domain d2cvzd2: 2cvz D:2-157 [130897]
    Other proteins in same PDB: d2cvza1, d2cvzb1, d2cvzc1, d2cvzd1
    automatically matched to d1j3vc2
    complexed with ndp

Details for d2cvzd2

PDB Entry: 2cvz (more details), 1.8 Å

PDB Description: Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8
PDB Compounds: (D:) 3-hydroxyisobutyrate dehydrogenase

SCOP Domain Sequences for d2cvzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvzd2 c.2.1.6 (D:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}
ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
gaeagtltvmlggpeeavervrpflayakkvvhvgp

SCOP Domain Coordinates for d2cvzd2:

Click to download the PDB-style file with coordinates for d2cvzd2.
(The format of our PDB-style files is described here.)

Timeline for d2cvzd2: