Lineage for d2cvra_ (2cvr A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394631Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)
  6. 2394632Protein DNA-binding protein [54162] (2 species)
  7. 2394642Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries)
    Uniprot P61991
  8. 2394647Domain d2cvra_: 2cvr A: [130889]
    automated match to d2cvra1
    mutant

Details for d2cvra_

PDB Entry: 2cvr (more details)

PDB Description: nmr solution structure of sso7d mutant, k12l, 12 conformers
PDB Compounds: (A:) DNA-binding protein 7a

SCOPe Domain Sequences for d2cvra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvra_ b.34.13.1 (A:) DNA-binding protein {Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

SCOPe Domain Coordinates for d2cvra_:

Click to download the PDB-style file with coordinates for d2cvra_.
(The format of our PDB-style files is described here.)

Timeline for d2cvra_: