![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins) |
![]() | Protein DNA-binding protein [54162] (2 species) |
![]() | Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries) Uniprot P61991 |
![]() | Domain d2cvra_: 2cvr A: [130889] automated match to d2cvra1 mutant |
PDB Entry: 2cvr (more details)
SCOPe Domain Sequences for d2cvra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvra_ b.34.13.1 (A:) DNA-binding protein {Sulfolobus solfataricus, Sso7d [TaxId: 2287]} atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek qk
Timeline for d2cvra_: