SCOPe 2.01: Domain d2cvra1: 2cvr A:1-62

Lineage for d2cvra1 (2cvr A:1-62)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (7 PDB entries)
   Uniprot P61991

8. Domain d2cvra1: 2cvr A:1-62 [130889]
   automatically matched to d1r83a_
   mutant

Details for d2cvra1

PDB Entry: 2cvr

PDB Description: nmr solution structure of sso7d mutant, k12l, 12 conformers

PDB Compounds: (A:) DNA-binding protein 7a

SCOPe Domain Sequences for d2cvra1:

Sequence; same for both SEQRES and ATOM records:

>d2cvra1 b.34.13.1 (A:1-62) DNA-binding protein {Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

Timeline for d2cvra1:

• d2cvra1 first appeared in SCOP 1.73
  
• d2cvra1 appears in SCOP 1.75
  
• d2cvra1 appears in SCOPe 2.02
  
• d2cvra1 appears in the current release, SCOPe 2.08, called d2cvra_