Lineage for d2cvra1 (2cvr A:1-62)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665974Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 665975Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 665976Protein DNA-binding protein [54162] (2 species)
  7. 665988Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries)
  8. 665992Domain d2cvra1: 2cvr A:1-62 [130889]
    automatically matched to d1r83a_
    mutant

Details for d2cvra1

PDB Entry: 2cvr (more details)

PDB Description: nmr solution structure of sso7d mutant, k12l, 12 conformers
PDB Compounds: (A:) DNA-binding protein 7a

SCOP Domain Sequences for d2cvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvra1 b.34.13.1 (A:1-62) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qk

SCOP Domain Coordinates for d2cvra1:

Click to download the PDB-style file with coordinates for d2cvra1.
(The format of our PDB-style files is described here.)

Timeline for d2cvra1: