Lineage for d2cvqb1 (2cvq B:0-153)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687902Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 688039Protein Malate dehydrogenase [51849] (12 species)
  7. 688135Species Thermus thermophilus [TaxId:274] [82300] (5 PDB entries)
    identical sequence to that from the Thermus flavus enzyme
  8. 688145Domain d2cvqb1: 2cvq B:0-153 [130887]
    Other proteins in same PDB: d2cvqa2, d2cvqb2
    automatically matched to d1iz9a1
    complexed with nap, trs

Details for d2cvqb1

PDB Entry: 2cvq (more details), 2.08 Å

PDB Description: Crystal structure of NAD(H)-dependent malate dehydrogenase complexed with NADPH
PDB Compounds: (B:) malate dehydrogenase

SCOP Domain Sequences for d2cvqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvqb1 c.2.1.5 (B:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta

SCOP Domain Coordinates for d2cvqb1:

Click to download the PDB-style file with coordinates for d2cvqb1.
(The format of our PDB-style files is described here.)

Timeline for d2cvqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cvqb2